Skip to product information
1 of 1

IL-17A, Human (CHO)

IL-17A, Human (CHO)

Size

SKU:QM-0191647-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Human (CHO) is a recombinant human IL-17A protein and is expressed in CHO cells. It consists of 155 amino acids (M1-A155) .

  • Molecular Formula

    3605 (Gene_ID) Q16552 (G24-A155) (Accession)

  • Smiles

    MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA

  • Purity

    90.1

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
5 µgQM-0191647-01
5 µgQM-0191647-01
£127.38/ea
£0.00
£127.38/ea £0.00
100 µgQM-0191647-02
100 µgQM-0191647-02
£879.85/ea
£0.00
£879.85/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-17A, Human (CHO)

IL-17A, Human (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.