Skip to product information
1 of 1

IL-17A, Mouse (CHO)

IL-17A, Mouse (CHO)

Size

SKU:QM-0202355-01

£81.92 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Mouse (CHO) is a recombinant mouse IL-17A protein and is expressed in CHO cells. It consists of 133 amino acids (A26-A158) .

  • Molecular Formula

    16171 (Gene_ID) Q62386 (A26-A158) (Accession)

  • Smiles

    AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA

  • Purity

    96

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202355-01
2 µgQM-0202355-01
£81.92/ea
£0.00
£81.92/ea £0.00
10 µgQM-0202355-02
10 µgQM-0202355-02
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0202355-03
50 µgQM-0202355-03
£448.52/ea
£0.00
£448.52/ea £0.00
100 µgQM-0202355-04
100 µgQM-0202355-04
£691.52/ea
£0.00
£691.52/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-17A, Mouse (CHO)

IL-17A, Mouse (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.