Skip to product information
1 of 1

IL-17A, Rat (His)

IL-17A, Rat (His)

Size

SKU:QM-0204817-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The IL-17A protein has important heterodimerization and homodimerization activities and is involved in a variety of processes, including responses to glucocorticoid stimulation and the regulation of cell death and transcription. IL-17A is present in the cytoplasm and extracellular space and has been implicated in diseases such as pancreatitis, inflammatory bowel disease, renal disease, and periodontal disease, and may serve as a biomarker. IL-17A Protein, Rat is the recombinant rat-derived IL-17A protein, expressed by E. coli.

  • Molecular Formula

    301289 (Gene_ID) NP_001100367 (A26-S158) (Accession)

  • Smiles

    AVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPEKCPFTFRVEKMLVGVGCTCVSSIVRHAS

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204817-01
2 µgQM-0204817-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0204817-02
10 µgQM-0204817-02
£99.25/ea
£0.00
£99.25/ea £0.00
50 µgQM-0204817-03
50 µgQM-0204817-03
£260.19/ea
£0.00
£260.19/ea £0.00
100 µgQM-0204817-04
100 µgQM-0204817-04
£381.69/ea
£0.00
£381.69/ea £0.00
500 µgQM-0204817-05
500 µgQM-0204817-05
£913.87/ea
£0.00
£913.87/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-17A, Rat (His)

IL-17A, Rat (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.