IL-17RD, Mouse (CHO)

Name: IL-17RD, Mouse (CHO)
Brand: QuantiMol
SKU: QM-0196746-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0196746-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
Interleukin-17 receptor D (IL-17RD) also known as Sef (similar expression to fibroblast growth factor), is a type I transmembrane protein that can regulate several signaling pathways. Within the cell, IL-17RD expression has been localized mainly to the plasma membrane. IL-17RD is a feedback inhibitor of fibroblast growth factor (FGF) signaling[1]. IL-17RD Protein, Mouse (CHO) is produced in CHO cells, and consists of 2713 amino acids (G29-R299) .
Molecular Formula
171463 (Gene_ID) Q8JZL1-1 (G29-R299) (Accession)
Smiles
GSGRARGADTCGWRGVGPASRNSGLHNITFRYDNCTTYLNPGGKHAIADAQNITISQYACHDQVAVTILWSPGALGIEFLKGFRVILEELKSEGRQCQQLILKDPKQLNSSFRRTGMESQPFLNMKFETDYFVKIVPFPSIKNESNYHPFFFRTRACDLLLQPDNLACKPFWKPRNLNISQHGSDMHVSFDHAPQNFGFRGFHVLYKLKHEGPFRRRTCRQDQNTETTSCLLQNVSPGDYIIELVDDSNTTRKAAQYVVKSVQSPWAGPIR
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0196746-01	2 µgQM-0196746-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0196746-02	10 µgQM-0196746-02 £91.38/ea	£0.00	Quantity	£91.38/ea	£0.00

50 µgQM-0196746-03	50 µgQM-0196746-03 £249.26/ea	£0.00	Quantity	£249.26/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-17RD, Mouse (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.