IL-18, Mouse (His)

Name: IL-18, Mouse (His)
Brand: QuantiMol
SKU: QM-0204825-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0204825-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-18 protein is a pro-inflammatory cytokine that plays an important role in epithelial barrier repair and immune response regulation by polarizing T helper 1 (Th1) cells and natural killer (NK) cells. After binding to IL18R1 and IL18RAP receptors, IL-18 forms a signaling ternary complex, activates NF-κ-B, and induces inflammatory mediators. IL-18 Protein, Mouse (His) is the recombinant mouse-derived IL-18 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
16173 (Gene_ID) P70380 (N36-S192) (Accession)
Smiles
NFGRLHCTTAVIRNINDQVLFVDKRQPVFEDMTDIDQSASEPQTRLIIYMYKDSEVRGLAVTLSVKDSKMSTLSCKNKIISFEEMDPPENIDDIQSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLILKKKDENGDKSVMFTLTNLHQS
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204825-01	2 µgQM-0204825-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0204825-02	10 µgQM-0204825-02 £127.38/ea	£0.00	Quantity	£127.38/ea	£0.00

50 µgQM-0204825-03	50 µgQM-0204825-03 £327.02/ea	£0.00	Quantity	£327.02/ea	£0.00

100 µgQM-0204825-04	100 µgQM-0204825-04 £520.20/ea	£0.00	Quantity	£520.20/ea	£0.00

500 µgQM-0204825-05	500 µgQM-0204825-05 £1,377.99/ea	£0.00	Quantity	£1,377.99/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-18, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.