IL-18, Rat

Name: IL-18, Rat
Brand: QuantiMol
SKU: QM-0203375-01
Price: 97.0 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203375-01

£97.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-18 Protein, Rat possesses immunoregulatory activities, including the stimulation of interferon (IFN) -γ production by T helper 1 (Th1) and natural killer cells, as well as other activities that promote inflammation.
Molecular Formula
29197 (Gene_ID) P97636-1 (H37-S194) (Accession)
Smiles
HFGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203375-01	2 µgQM-0203375-01 £97.00/ea	£0.00	Quantity	£97.00/ea	£0.00

10 µgQM-0203375-02	10 µgQM-0203375-02 £260.19/ea	£0.00	Quantity	£260.19/ea	£0.00

50 µgQM-0203375-03	50 µgQM-0203375-03 £680.59/ea	£0.00	Quantity	£680.59/ea	£0.00

100 µgQM-0203375-04	100 µgQM-0203375-04 £996.49/ea	£0.00	Quantity	£996.49/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-18, Rat is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.