Name: IL-18BP, Human (HEK293, hFc)
Brand: QuantiMol
SKU: QM-0205876-01
Price: 52.94 GBP
Availability: InStock

Product Details

Description
IL-18BP Protein belongs to immunoglobulin superfamily that bind to IL-18 and inhibits its activity. IL-18BP Protein functions as an inhibitor of the Th1 cytokine response[1]. IL-18BP Protein, Human (HEK293, hFc) is the recombinant human-derived IL-18BP protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
10068 (Gene_ID) AAD17187.1 (T29-G192) (Accession)
Smiles
TPVSQTTTAATASVRSTKDPCPSQPPVFPAAKQCPALEVTWPEVEVPLNGTLSLSCVACSRFPNFSILYWLGNGSFIEHLPGRLWEGSTSRERGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPEQVVQRHVVLAQLWAGLRATLPPTQEALPSSHSSPQQQG
Purity
97
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0205876-01	2 µgQM-0205876-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

5 µgQM-0205876-02	5 µgQM-0205876-02 £68.47/ea	£0.00	Quantity	£68.47/ea	£0.00

10 µgQM-0205876-03	10 µgQM-0205876-03 £81.92/ea	£0.00	Quantity	£81.92/ea	£0.00

50 µgQM-0205876-04	50 µgQM-0205876-04 £147.63/ea	£0.00	Quantity	£147.63/ea	£0.00

100 µgQM-0205876-05	100 µgQM-0205876-05 £235.90/ea	£0.00	Quantity	£235.90/ea	£0.00

500 µgQM-0205876-06	500 µgQM-0205876-06 £531.14/ea	£0.00	Quantity	£531.14/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-18BP, Human (HEK293, hFc)

IL-18BP, Human (HEK293, hFc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.