IL-18BP, Mouse (HEK293, Fc)

Name: IL-18BP, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0180318-01
Price: 133.0 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0180318-01

£133.00 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-18BP protein regulates immune processes by binding to interleukin-18 (IL-18), inhibiting its activity. This interaction positions IL-18BP as a key inhibitor of the early TH1 cytokine response, emphasizing its role in immune modulation and potential contribution to regulating inflammatory responses. IL-18BP Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-18BP protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
16068 (Gene_ID) Q9Z0M9 (T29-A193) (Accession)
Smiles
TSAPQTTATVLTGSSKDPCSSWSPAVPTKQYPALDVIWPEKEVPLNGTLTLSCTACSRFPYFSILYWLGNGSFIEHLPGRLKEGHTSREHRNTSTWLHRALVLEELSPTLRSTNFSCLFVDPGQVAQYHIILAQLWDGLKTAPSPSQETLSSHSPVSRSAGPGVA
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0180318-01	10 µgQM-0180318-01 £133.00/ea	£0.00	Quantity	£133.00/ea	£0.00

50 µgQM-0180318-02	50 µgQM-0180318-02 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-18BP, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.