IL-19, Human

Name: IL-19, Human
Brand: QuantiMol
SKU: QM-0191788-01
Price: 282.06 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0191788-01

£282.06 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-19 Protein, Human is a member of the Interleukin-10 family. The biological functions and clinical implications of Interleukin-19 is still undefined.
Molecular Formula
29949 (Gene_ID) Q9UHD0-1 (L25-A177) (Accession)
Smiles
LRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNYDQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0191788-01	10 µgQM-0191788-01 £282.06/ea	£0.00	Quantity	£282.06/ea	£0.00

50 µgQM-0191788-02	50 µgQM-0191788-02 £736.48/ea	£0.00	Quantity	£736.48/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-19, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.