Skip to product information
1 of 1

IL-1R1, Cynomolgus (HEK293, His)

IL-1R1, Cynomolgus (HEK293, His)

Size

SKU:QM-0204552-01

£58.12 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM) [1]. IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB and MAPK pathway[4]. IL-1R1 Protein, Cynomolgus (HEK293, His) is a recombinant cynomolgus extracellular region of IL-1R1 (M1-T332) with a C-Terminal His tag, which is produced in HEK293 cells.

  • Molecular Formula

    711726 (Gene_ID) F7GVA6 (D21-T332) (Accession)

  • Smiles

    DKCNEREEKIILVSSANEIDVRPCPLNPNEYKGTITWYKNDSKTPISTEQASRIHQHKKKLWFVPAKVEDSGHYYCVVRNSSYCLRIKITAKFVENEPNLCYNAEAIFKQRLPVAGDGGLVCPYMEFFKDENNELPKLLWYKDCKPLLLDNIHFSGVKDRLIVMNVAEKHRGNYTCHASYTYLGKQYPITRVIEFITLEENKPTRPVIVSPANETIEVDLGSQIQLICNVTGQLSDTAYWKWNGSFIDEDDPVLGEDYYSVENPANKRRSTLITVLNISETESRFYKHPFTCLARNTHGMDAAYVQLIYPVT

  • Purity

    96.3

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204552-01
2 µgQM-0204552-01
£58.12/ea
£0.00
£58.12/ea £0.00
10 µgQM-0204552-02
10 µgQM-0204552-02
£81.92/ea
£0.00
£81.92/ea £0.00
50 µgQM-0204552-03
50 µgQM-0204552-03
£232.25/ea
£0.00
£232.25/ea £0.00
100 µgQM-0204552-04
100 µgQM-0204552-04
£359.82/ea
£0.00
£359.82/ea £0.00
500 µgQM-0204552-05
500 µgQM-0204552-05
£979.48/ea
£0.00
£979.48/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-1R1, Cynomolgus (HEK293, His)

IL-1R1, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.