Skip to product information
1 of 1

IL-1R1, Mouse (HEK293, His)

IL-1R1, Mouse (HEK293, His)

Size

SKU:QM-0193646-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-1R1 (CD121a) belongs to IL-1 receptor, and binds to IL-1α, IL-1β, IL-1Ra and IL-38 with comparable affinities (Kd: 0.1-1 nM) [1]. IL-1R1 regulates the transcription of multiple proinflammatory cytokines and mediates immune and inflammatory responses, including the activation of NF-κB and MAPK pathway[4]. IL-1R1 Protein, Mouse (HEK293, His) is a recombinant mouse extracellular region of IL-1R1 (L20-K338) with a C terminal 6*His tag, which is produced in HEK293 cells.

  • Molecular Formula

    16177 (Gene_ID) P13504 (L20-K338) (Accession)

  • Smiles

    LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFK

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0193646-01
10 µgQM-0193646-01
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0193646-02
50 µgQM-0193646-02
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-1R1, Mouse (HEK293, His)

IL-1R1, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.