Skip to product information
1 of 1

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

Size

SKU:QM-0188167-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The IL-1RL2 protein functions as a receptor for interleukin 36 (IL36A, IL36B, and IL36G) and upon binding forms a complex with the coreceptor IL1RAP. This IL-36 receptor complex plays a key role in activating NF-κ-B, MAPK, and other signaling pathways. IL-1RL2 Protein, Mouse (A158V, HEK293, His) is the recombinant mouse-derived IL-1RL2 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    107527 (Gene_ID) Q9ERS7 (D22-R338, A158V) (Accession)

  • Smiles

    DTCEDIFMHNVIISEGQPFPFNCTYPPETNGAVNLTWYKTPSKSPVSNNRHLRVHQDQTWILFLPLTLEDSGIYQCVIRNAHNCYQIAVNLTVLKNHWCDSSMEGSPVNSPDVYQQILPIGKSGSLNCHLYFPESCVLDSIKWYKGCEEIKAGKKYSPSGAKLLVNNVAVEDGGSYACSARLTHLGRHFTIRNYIAVNTKEVEYGRRIPNITYPKNNSIEVPLGSTLIVNCNITDTKENTNLRCWRVNNTLVDDYYKDSKRIQEGIETNVSLRDQIRYTVNITFLKVKMEDYGRPFTCHAGVSAAYIILIYPVPDFR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0188167-01
10 µgQM-0188167-01
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0188167-02
50 µgQM-0188167-02
£359.82/ea
£0.00
£359.82/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-1RL2 Protein, Mouse (A158V, HEK293, His)

IL-1RL2 Protein, Mouse (A158V, HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.