IL-20, Human

Name: IL-20, Human
Brand: QuantiMol
SKU: QM-0170098-01
Price: 227.39 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0170098-01

£227.39 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-20 Protein, Human is a member of the IL-10 family of cytokines. Interleukin-20 binds to the IL-20 heterodimeric receptor with a Kd of 1.5 nM.
Molecular Formula
50604 (Gene_ID) Q9NYY1-1 (L25-E176) (Accession)
Smiles
MLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0170098-01	10 µgQM-0170098-01 £227.39/ea	£0.00	Quantity	£227.39/ea	£0.00

50 µgQM-0170098-02	50 µgQM-0170098-02 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-20, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.