Skip to product information
1 of 1

IL-20R beta Protein, Human (HEK293, Fc)

IL-20R beta Protein, Human (HEK293, Fc)

Size

SKU:QM-0189586-01

£142.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-20R beta Protein (IL20RB) is the beta subunit of IL-20 receptor, forms functional heterodimers with different subunit protein and involves in STAT3 activation pathway[1]. The IL-20RA/IL-20RB dimer is a receptor for IL-19, IL-20 and IL-24. The IL-22RA1/IL-20RB dimer is a receptor for IL-20 and IL-24[2]. IL-20R beta Protein is consists of 308 amino acids (M1-S311) with a transmembrane domain (230-254 a.a.) . IL-20R beta Protein, Cynomolgus (HEK293, His) is fibronectin type-III domain-containing protein, produced in HEK293 cells with a C-Terminal His-tag.

  • Molecular Formula

    53833 (Gene_ID) Q6UXL0-1 (D30-A230) (Accession)

  • Smiles

    DEVAILPAPQNLSVLSTNMKHLLMWSPVIAPGETVYYSVEYQGEYESLYTSHIWIPSSWCSLTEGPECDVTDDITATVPYNLRVRATLGSQTSAWSILKHPFNRNSTILTRPGMEITKDGFHLVIELEDLGPQFEFLVAYWRREPGAEEHVKMVRSGGIPVHLETMEPGAAYCVKAQTFVKAIGRYSAFSQTECVEVQGEA

  • Purity

    95

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0189586-01
10 µgQM-0189586-01
£142.25/ea
£0.00
£142.25/ea £0.00
50 µgQM-0189586-02
50 µgQM-0189586-02
£352.02/ea
£0.00
£352.02/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-20R beta Protein, Human (HEK293, Fc)

IL-20R beta Protein, Human (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.