IL-21, Mouse

Name: IL-21, Mouse
Brand: QuantiMol
SKU: QM-0203414-01
Price: 79.85 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203414-01

£79.85 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-21 Protein, Mouse is a regulatory cytokine thought to play a role in the transition between innate and adaptive immunity.
Molecular Formula
60505 (Gene_ID) Q9ES17 (H18-S146) (Accession)
Smiles
HKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203414-01	2 µgQM-0203414-01 £79.85/ea	£0.00	Quantity	£79.85/ea	£0.00

10 µgQM-0203414-02	10 µgQM-0203414-02 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

50 µgQM-0203414-03	50 µgQM-0203414-03 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

100 µgQM-0203414-04	100 µgQM-0203414-04 £802.09/ea	£0.00	Quantity	£802.09/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-21, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.