Skip to product information
1 of 1

IL-21, Mouse (His)

IL-21, Mouse (His)

Size

SKU:QM-0176140-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-21 is a cytokine with immunomodulatory capabilities that orchestrates the transition from innate to adaptive immunity. It induces the production of IgG (1) and IgG (3) by B cells, thereby forming a humoral immune response. IL-21 Protein, Mouse (His) is the recombinant mouse-derived IL-21 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    60505 (Gene_ID) Q9ES17 (P25-S146) (Accession)

  • Smiles

    PDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0176140-01
10 µgQM-0176140-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0176140-02
50 µgQM-0176140-02
£548.15/ea
£0.00
£548.15/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-21, Mouse (His)

IL-21, Mouse (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.