IL-21R, Mouse (HEK293, Fc)

Name: IL-21R, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0169105-01
Price: 58.12 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg 500 µg

SKU:QM-0169105-01

£58.12 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
The IL-21R protein is specifically designed for IL-21 and forms a heterodimeric complex with the common γ subunit, which is critical for signal transduction. This receptor complex promotes interaction with Janus kinase 1 (JAK1), initiating downstream signaling events in response to interleukin-21. IL-21R Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-21R protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
60504 (Gene_ID) Q9JHX3 (C20-P236) (Accession)
Smiles
CLDLTCYTDYLWTITCVLETRSPNPSILSLTWQDEYEELQDQETFCSLHRSGHNTTHIWYTCHMRLSQFLSDEVFIVNVTDQSGNNSQECGSFVLAESIKPAPPLNVTVAFSGRYDISWDSAYDEPSNYVLRGKLQYELQYRNLRDPYAVRPVTKLISVDSRNVSLLPEEFHKDSSYQLQVRAAPQPGTSFRGTWSEWSDPVIFQTQAGEPEAGWDP
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0169105-01	2 µgQM-0169105-01 £58.12/ea	£0.00	Quantity	£58.12/ea	£0.00

10 µgQM-0169105-02	10 µgQM-0169105-02 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

50 µgQM-0169105-03	50 µgQM-0169105-03 £205.52/ea	£0.00	Quantity	£205.52/ea	£0.00

100 µgQM-0169105-04	100 µgQM-0169105-04 £316.08/ea	£0.00	Quantity	£316.08/ea	£0.00

500 µgQM-0169105-05	500 µgQM-0169105-05 £901.72/ea	£0.00	Quantity	£901.72/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-21R, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.