1 1

IL-22, Human

IL-22, Human

Size

QM-0205489-01

£62.26 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    IL-22 Protein, Human is a cytokine protein and intricate member of the immune response.

  • Molecular Formula

    50616 (Gene_ID) Q9GZX6 (A34-I179) (Accession)

  • Smiles

    APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0205489-01
2 µgQM-0205489-01
£62.26/ea		 £0.00
£62.26/ea £0.00
10 µgQM-0205489-02
10 µgQM-0205489-02
£127.38/ea		 £0.00
£127.38/ea £0.00
50 µgQM-0205489-03
50 µgQM-0205489-03
£359.82/ea		 £0.00
£359.82/ea £0.00
100 µgQM-0205489-04
100 µgQM-0205489-04
£548.15/ea		 £0.00
£548.15/ea £0.00
500 µgQM-0205489-05
500 µgQM-0205489-05
£1,377.99/ea		 £0.00
£1,377.99/ea £0.00
1 mgQM-0205489-06
1 mgQM-0205489-06
£2,153.16/ea		 £0.00
£2,153.16/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

IL-22, Human

IL-22, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.