Skip to product information
1 of 1

IL-22, Mouse (CHO)

IL-22, Mouse (CHO)

Size

SKU:QM-0202455-01

£70.54 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-22 Protein is an secreted IL-10 family cytokine that take part in inflammation responses, reactive oxygen species metabolic process as well as the regeneration and spreading of epithelial cells. IL22 promotes cell survival and proliferation through STAT3, ERK1/2, MAPK and PI3K/AKT pathways. IL-22 Protein, Mouse (CHO) is the recombinant mouse-derived IL-22 protein, expressed by CHO , with tag free.

  • Molecular Formula

    50929 (Gene_ID) Q9JJY9 (L34-V179) (Accession)

  • Smiles

    LPVNTRCKLEVSNFQQPYIVNRTFMLAKEASLADNNTDVRLIGEKLFRGVSAKDQCYLMKQVLNFTLEDVLLPQSDRFQPYMQEVVPFLTKLSNQLSSCHISGDDQNIQKNVRRLKETVKKLGESGEIKAIGELDLLFMSLRNACV

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0202455-01
2 µgQM-0202455-01
£70.54/ea
£0.00
£70.54/ea £0.00
10 µgQM-0202455-02
10 µgQM-0202455-02
£188.51/ea
£0.00
£188.51/ea £0.00
50 µgQM-0202455-03
50 µgQM-0202455-03
£437.58/ea
£0.00
£437.58/ea £0.00
100 µgQM-0202455-04
100 µgQM-0202455-04
£714.61/ea
£0.00
£714.61/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-22, Mouse (CHO)

IL-22, Mouse (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.