IL-22BP/IL-22RA2, Human (HEK293, His)

Name: IL-22BP/IL-22RA2, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0183403-01
Price: 268.7 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0183403-01

£268.70 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-22BP/IL-22RA2 proteins (especially isoform 2) act as IL22 receptors and antagonists, inhibiting IL22 activity by preventing its interaction with functional IL-22R complexes in vitro. This regulatory effect suggests its potential in modulating inflammatory responses. IL-22BP/IL-22RA2 Protein, Human (HEK293, His) is the recombinant human-derived IL-22BP/IL-22RA2 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
116379 (Gene_ID) Q969J5-2 (T22-P231) (Accession)
Smiles
TQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0183403-01	10 µgQM-0183403-01 £268.70/ea	£0.00	Quantity	£268.70/ea	£0.00

50 µgQM-0183403-02	50 µgQM-0183403-02 £590.67/ea	£0.00	Quantity	£590.67/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-22BP/IL-22RA2, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.