IL-22R alpha 1, Mouse (HEK293, Fc)

Name: IL-22R alpha 1, Mouse (HEK293, Fc)
Brand: QuantiMol
SKU: QM-0182103-01
Price: 299.07 GBP
Availability: InStock

Size 20 µg 50 µg

SKU:QM-0182103-01

£299.07 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-22R α 1 and IL-10R β together form IL20, IL22 and IL24 receptor complexes, activating different signaling pathways. Within the IL22 receptor, IL-22R α 1 binds to IL10RB and mediates IL22 signaling through the JAK/STAT and MAPK1/MAPK3/Akt pathways. IL-22R alpha 1 Protein, Mouse (HEK293, Fc) is the recombinant mouse-derived IL-22R alpha 1 protein, expressed by HEK293 , with C-hFc labeled tag.
Molecular Formula
230828 (Gene_ID) Q80XZ4 (H16-A228) (Accession)
Smiles
HTTVDTSGLLQHVKFQSSNFENILTWDGGPASTSDTVYSVEYKKYGERKWLAKAGCQRITQKFCNLTMETRNHTEFYYAKVTAVSAGGPPVTKMTDRFSSLQHTTIKPPDVTCIPKVRSIQMLVHPTLTPVLSEDGHQLTLEEIFHDLFYRLELHVNHTYQMHLEGKQREYEFLGLTPDTEFLGSITILTPILSKESAPYVCRVKTLPDRTWA
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
20 µgQM-0182103-01	20 µgQM-0182103-01 £299.07/ea	£0.00	Quantity	£299.07/ea	£0.00

50 µgQM-0182103-02	50 µgQM-0182103-02 £548.15/ea	£0.00	Quantity	£548.15/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-22R alpha 1, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.