IL-23, Mouse (HEK293)

Name: IL-23, Mouse (HEK293)
Brand: QuantiMol
SKU: QM-0169390-01
Price: 75.72 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg

SKU:QM-0169390-01

£75.72 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-23 alpha is a key component that binds to IL12B to produce IL-23 interleukin, a heterodimeric cytokine critical in innate and adaptive immunity. IL-23 functions together with IL-17 in peripheral tissues to respond acutely to infection. IL-23 alpha (175a.a) & IL-12 beta (313a.a) Heterodimer Protein, Mouse (HEK293) is a recombinant protein dimer complex containing mouse-derived IL-23 alpha, expressed by HEK293 , with tag free.
Molecular Formula
83430&16160 (Gene_ID) Q9EQ14 (V22-A196) &P43432 (M23-S335) (Accession)
Smiles
VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDNSQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSLSSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA&MWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWEYPDSWSTPHSYFSLKFFVRIQRKKEKMKETEEGCNQKGAFLVEKTSTEVQCKGGNVCVQAQDRYYNSSCSKWACVPCRVRS
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0169390-01	2 µgQM-0169390-01 £75.72/ea	£0.00	Quantity	£75.72/ea	£0.00

10 µgQM-0169390-02	10 µgQM-0169390-02 £216.46/ea	£0.00	Quantity	£216.46/ea	£0.00

50 µgQM-0169390-03	50 µgQM-0169390-03 £515.35/ea	£0.00	Quantity	£515.35/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-23, Mouse (HEK293) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.