IL-25/IL-17E, Human (HEK293, His)

Name: IL-25/IL-17E, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0171424-01
Price: 76.75 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0171424-01

£76.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-25/IL-17E cytokines are produced by eosinophils, Th2 cells, and epithelial cells and critically regulate the adaptive immune response by modulating cytokine production. It enhances local and systemic type 2 helper T cell responses through its IL17RA and IL17RB receptors and activates the JAK2-STAT5A pathway. IL-25/IL-17E Protein, Human (HEK293, His) is the recombinant human-derived IL-25/IL-17E protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
64806 (Gene_ID) Q9H293-1 (Y33-G177) (Accession)
Smiles
YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0171424-01	2 µgQM-0171424-01 £76.75/ea	£0.00	Quantity	£76.75/ea	£0.00

10 µgQM-0171424-02	10 µgQM-0171424-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0171424-03	50 µgQM-0171424-03 £420.57/ea	£0.00	Quantity	£420.57/ea	£0.00

100 µgQM-0171424-04	100 µgQM-0171424-04 £641.71/ea	£0.00	Quantity	£641.71/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-25/IL-17E, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.