Skip to product information
1 of 1

IL-2R gamma/CD132, Mouse (HEK293, His-Fc)

IL-2R gamma/CD132, Mouse (HEK293, His-Fc)

Size

SKU:QM-0204268-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-2R gamma (CD132), a type I cytokine receptor expressed on leucocyte subsets, is a receptor for IL-2. IL-2R gamma forms heterodimer with IL-2R beta, and increases the affinity of IL-2R beta for IL-2. IL-2R gamma takes part in inflammatory response and mediates activation of the cells [1][2]. IL-2R gamma plays an important role in the development, activation, proliferation, differentiation and regulation of lymphocytes and other cell types[3]. IL-2R gamma/CD132 Protein, Mouse (HEK293, His-Fc) is a recombinant mice extracellular region of IL-2R gamma with a C-Terminal hFc and a His tag, which is produced in HEK293 cells.

  • Molecular Formula

    16186 (Gene_ID) P34902/NP_038591.1 (W23-A263) (Accession)

  • Smiles

    WSSKVLMSSANEDIKADLILTSTAPEHLSAPTLPLPEVQCFVFNIEYMNCTWNSSSEPQATNLTLHYRYKVSDNNTFQECSHYLFSKEITSGCQIQKEDIQLYQTFVVQLQDPQKPQRRAVQKLNLQNLVIPRAPENLTLSNLSESQLELRWKSRHIKERCLQYLVQYRSNRDRSWTELIVNHEPRFSLPSVDELKRYTFRVRSRYNPICGSSQQWSKWSQPVHWGSHTVEENPSLFALEA

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0204268-01
2 µgQM-0204268-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0204268-02
10 µgQM-0204268-02
£99.25/ea
£0.00
£99.25/ea £0.00
50 µgQM-0204268-03
50 µgQM-0204268-03
£260.19/ea
£0.00
£260.19/ea £0.00
100 µgQM-0204268-04
100 µgQM-0204268-04
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-2R gamma/CD132, Mouse (HEK293, His-Fc)

IL-2R gamma/CD132, Mouse (HEK293, His-Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.