Skip to product information
1 of 1

IL-3, Human

IL-3, Human

Size

SKU:QM-0199119-01

£62.26 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-3 Protein, Human is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure. IL-3 Protein, Human plays a role in neural cell proliferation and survival. IL-3 Protein, Human inhibits NF-κB nuclear translocation and activation, and inhibits osteoclast differentiation. IL-3 Protein, Human is the recombinant human-derived IL-2 Protein, expressed by E. coli.

  • Molecular Formula

    3562 (Gene_ID) P08700 (A20-F152) (Accession)

  • Smiles

    APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0199119-01
2 µgQM-0199119-01
£62.26/ea
£0.00
£62.26/ea £0.00
10 µgQM-0199119-02
10 µgQM-0199119-02
£134.13/ea
£0.00
£134.13/ea £0.00
50 µgQM-0199119-03
50 µgQM-0199119-03
£381.69/ea
£0.00
£381.69/ea £0.00
100 µgQM-0199119-04
100 µgQM-0199119-04
£580.96/ea
£0.00
£580.96/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-3, Human

IL-3, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.