IL-3, Mouse (HEK293, His)

Name: IL-3, Mouse (HEK293, His)
Brand: QuantiMol
SKU: QM-0204304-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204304-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-3 Protein, Mouse (HEK293, His) is a multilineage hematopoietic cytokine with promising effects on platelet and neutrophil counts and special usefulness in patients with secondary hematopoietic failure.
Molecular Formula
16187 (Gene_ID) P01586 (A27-C166) (Accession)
Smiles
ASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204304-01	2 µgQM-0204304-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0204304-02	10 µgQM-0204304-02 £199.44/ea	£0.00	Quantity	£199.44/ea	£0.00

50 µgQM-0204304-03	50 µgQM-0204304-03 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

100 µgQM-0204304-04	100 µgQM-0204304-04 £669.65/ea	£0.00	Quantity	£669.65/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-3, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.