IL-3, Rhesus macaque (His)

Name: IL-3, Rhesus macaque (His)
Brand: QuantiMol
SKU: QM-0202620-01
Price: 90.25 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0202620-01

£90.25 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-3 protein, a hematopoietic cytokine, regulates hematopoiesis by influencing the production, differentiation, and function of various white blood cell populations. It acts as a colony-stimulating factor, promoting the development and maturation of these cell types and maintaining a functional immune system. IL-3 Protein, Rhesus macaque (His) is the recombinant Rhesus Macaque-derived IL-3 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
706946 (Gene_ID) P25140 (A20-Q143) (Accession)
Smiles
APMTQTTSLKTSWAKCSNMIDEIITHLNQPPLPSPDFNNLNEEDQTILVEKNLRRSNLEAFSKAVKSLQNASAIESILKNLPPCLPMATAAPTRPPIRITNGDRNDFRRKLKFYLKTLENEQAQ
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0202620-01	2 µgQM-0202620-01 £90.25/ea	£0.00	Quantity	£90.25/ea	£0.00

10 µgQM-0202620-02	10 µgQM-0202620-02 £248.04/ea	£0.00	Quantity	£248.04/ea	£0.00

50 µgQM-0202620-03	50 µgQM-0202620-03 £604.04/ea	£0.00	Quantity	£604.04/ea	£0.00

100 µgQM-0202620-04	100 µgQM-0202620-04 £990.41/ea	£0.00	Quantity	£990.41/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-3, Rhesus macaque (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.