1 1

IL-33, Human

IL-33, Human

Size

QM-0205516-01

£67.44 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    IL-33 Protein, Human, a Th2 cytokine, is a specific ligand for ST2L.

  • Molecular Formula

    90865 (Gene_ID) O95760-1 (S112-T270) (Accession)

  • Smiles

    SITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNMHSNCVSFECKTDPGVFIGVKDNHLALIKVDSSENLCTENILFKLSET

  • Purity

    97

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0205516-01
2 µgQM-0205516-01
£67.44/ea		 £0.00
£67.44/ea £0.00
10 µgQM-0205516-02
10 µgQM-0205516-02
£188.51/ea		 £0.00
£188.51/ea £0.00
50 µgQM-0205516-03
50 µgQM-0205516-03
£437.58/ea		 £0.00
£437.58/ea £0.00
100 µgQM-0205516-04
100 µgQM-0205516-04
£708.53/ea		 £0.00
£708.53/ea £0.00
500 µgQM-0205516-05
500 µgQM-0205516-05
£1,710.90/ea		 £0.00
£1,710.90/ea £0.00
1 mgQM-0205516-06
1 mgQM-0205516-06
£2,705.99/ea		 £0.00
£2,705.99/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

IL-33, Human

IL-33, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.