IL-33, Mouse

Name: IL-33, Mouse
Brand: QuantiMol
SKU: QM-0203770-01
Price: 72.61 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203770-01

£72.61 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-33 Protein, Mouse is a tissue-derived nuclear cytokine from the IL-1 family abundantly expressed in endothelial cells, epithelial cells and fibroblast-like cells, both during homeostasis and inflammation.
Molecular Formula
77125 (Gene_ID) Q8BVZ5 (S109-I266) (Accession)
Smiles
SIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203770-01	2 µgQM-0203770-01 £72.61/ea	£0.00	Quantity	£72.61/ea	£0.00

10 µgQM-0203770-02	10 µgQM-0203770-02 £210.38/ea	£0.00	Quantity	£210.38/ea	£0.00

50 µgQM-0203770-03	50 µgQM-0203770-03 £623.48/ea	£0.00	Quantity	£623.48/ea	£0.00

100 µgQM-0203770-04	100 µgQM-0203770-04 £1,029.29/ea	£0.00	Quantity	£1,029.29/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-33, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.