Skip to product information
1 of 1

IL-36 alpha/IL-1F6, Mouse

IL-36 alpha/IL-1F6, Mouse

Size

SKU:QM-0205988-01

£55.02 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-36 alpha (IL-1F6), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 alpha mediates inflammatory response. IL-36 alpha binds to IL-36R and activates NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1]. IL-36 alpha also binds to IL-1Rrp2 and recruit IL-1RAcP. IL-36 alpha activats the MAPK, Erk1/2 and JNK through IL-36R/IL-1RAcP[2]. IL-36 alpha/IL-1F6 Protein, Mouse is a recombinant mouse IL-36 alpha without any tag, which is produced in E. coli.

  • Molecular Formula

    54448 (Gene_ID) Q9JLA2 (R8-H160) (Accession)

  • Smiles

    RAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0205988-01
2 µgQM-0205988-01
£55.02/ea
£0.00
£55.02/ea £0.00
10 µgQM-0205988-02
10 µgQM-0205988-02
£109.38/ea
£0.00
£109.38/ea £0.00
20 µgQM-0205988-03
20 µgQM-0205988-03
£193.37/ea
£0.00
£193.37/ea £0.00
50 µgQM-0205988-04
50 µgQM-0205988-04
£327.02/ea
£0.00
£327.02/ea £0.00
100 µgQM-0205988-05
100 µgQM-0205988-05
£520.20/ea
£0.00
£520.20/ea £0.00
500 µgQM-0205988-06
500 µgQM-0205988-06
£1,377.99/ea
£0.00
£1,377.99/ea £0.00
1 mgQM-0205988-07
1 mgQM-0205988-07
£1,986.71/ea
£0.00
£1,986.71/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-36 alpha/IL-1F6, Mouse

IL-36 alpha/IL-1F6, Mouse is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.