Skip to product information
1 of 1

IL-36 gamma/IL-1F9, Human

IL-36 gamma/IL-1F9, Human

Size

SKU:QM-0191600-01

£67.44 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-36 gamma (IL-1F9), a subform of IL-36 family, belongs to IL-1 superfamily. IL-36 gamma mediates inflammatory response. L-36 beta binds to IL-36R and recruits the co-receptor IL-1RacP, and thereby activating NF-κB and MAPK signaling pathways, but the activation requires N-terminal cleavage by neutrophil granule-derived proteases[1][2]. IL-36 gamma/IL-1F9 Protein, Human is a recombinant human IL-36 gamma without any tag, which is produced in E. coli.

  • Molecular Formula

    56300 (Gene_ID) Q9NZH8-1 (S18-D169) (Accession)

  • Smiles

    SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0191600-01
2 µgQM-0191600-01
£67.44/ea
£0.00
£67.44/ea £0.00
10 µgQM-0191600-02
10 µgQM-0191600-02
£147.63/ea
£0.00
£147.63/ea £0.00
50 µgQM-0191600-03
50 µgQM-0191600-03
£381.69/ea
£0.00
£381.69/ea £0.00
100 µgQM-0191600-04
100 µgQM-0191600-04
£580.96/ea
£0.00
£580.96/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-36 gamma/IL-1F9, Human

IL-36 gamma/IL-1F9, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.