Skip to product information
1 of 1

IL-3R alpha/CD123, Cynomolgus (HEK293, His)

IL-3R alpha/CD123, Cynomolgus (HEK293, His)

Size

SKU:QM-0185855-01

£99.25 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-3R α/CD123 protein is an important member of the type I cytokine receptor family and mediates cellular responses to a variety of cytokines, emphasizing its key role in hematopoiesis and immune regulation. IL-3R alpha/CD123 Protein, Cynomolgus (HEK293, His) is the recombinant cynomolgus-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.

  • Molecular Formula

    102138639 (Gene_ID) G8F3K3 (R18-R302) (Accession)

  • Smiles

    RTKEDPNAPIRNLRMKEKAQQLMWDLNRNVTDVECIKGTDYSMPAMNNSYCQFGAISLCEVTNYTVRVASPPFSTWILFPENSGTPRAGAENLTCWVHDVDFLSCSWVVGPAAPADVQYDLYLNNPNSHEQYRCLHYKTDARGTQIGCRFDDIAPLSRGSQSSHILVRGRSAAVSIPCTDKFVFFSQIERLTPPNMTGECNETHSFMHWKMKSHFNRKFRYELRIQKRMQPVRTEQVRDTTSFQLPNPGTYTVQIRARETVYEFLSAWSTPQRFECDQEEGASSR

  • Purity

    97.55

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0185855-01
10 µgQM-0185855-01
£99.25/ea
£0.00
£99.25/ea £0.00
50 µgQM-0185855-02
50 µgQM-0185855-02
£271.13/ea
£0.00
£271.13/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-3R alpha/CD123, Cynomolgus (HEK293, His)

IL-3R alpha/CD123, Cynomolgus (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.