IL-3R alpha/CD123, Human (Biotinylated, HEK293, Fc-Avi)
IL-3R alpha/CD123, Human (Biotinylated, HEK293, Fc-Avi)
SKU:QM-0107178
Request quote or documents

Product Details
-
Description
FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.
-
Molecular Formula
3563 (Gene_ID) P26951-1 (T19-R305) (Accession)
-
Smiles
TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
IL-3R alpha/CD123, Human (Biotinylated, HEK293, Fc-Avi)
IL-3R alpha/CD123, Human (Biotinylated, HEK293, Fc-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.