Skip to product information
1 of 1

IL-3R alpha/CD123, Human (Biotinylated, HEK293, Fc-Avi)

IL-3R alpha/CD123, Human (Biotinylated, HEK293, Fc-Avi)

Size

SKU:QM-0107178

Price on request
Quantity

Request quote or documents

View full details
  • Description

    FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (Biotinylated, HEK293, Fc-Avi) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-Avi, C-hFc labeled tag.

  • Molecular Formula

    3563 (Gene_ID) P26951-1 (T19-R305) (Accession)

  • Smiles

    TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0107178
1 EachQM-0107178
£0.00/ea
£0.00
£0.00/ea £0.00

IL-3R alpha/CD123, Human (Biotinylated, HEK293, Fc-Avi)

IL-3R alpha/CD123, Human (Biotinylated, HEK293, Fc-Avi) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.