Name: IL-3R alpha/CD123, Human (HEK293, His)
Brand: QuantiMol
SKU: QM-0179218-01
Price: 52.94 GBP
Availability: InStock

Product Details

Description
FITC-tagged IL-3R α/CD123 is a cell surface receptor for IL3 expressed on hematopoietic progenitor cells, monocytes, and B lymphocytes, regulating their production and differentiation. IL-3R alpha/CD123 Protein, Human (HEK293, His) is the recombinant human-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-6*His labeled tag.
Molecular Formula
3563 (Gene_ID) P26951-1 (T19-R305) (Accession)
Smiles
TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0179218-01	2 µgQM-0179218-01 £52.94/ea	£0.00	Quantity	£52.94/ea	£0.00

10 µgQM-0179218-02	10 µgQM-0179218-02 £101.50/ea	£0.00	Quantity	£101.50/ea	£0.00

50 µgQM-0179218-03	50 µgQM-0179218-03 £271.13/ea	£0.00	Quantity	£271.13/ea	£0.00

100 µgQM-0179218-04	100 µgQM-0179218-04 £437.58/ea	£0.00	Quantity	£437.58/ea	£0.00

500 µgQM-0179218-05	500 µgQM-0179218-05 £1,544.45/ea	£0.00	Quantity	£1,544.45/ea	£0.00

1 mgQM-0179218-06	1 mgQM-0179218-06 £2,430.18/ea	£0.00	Quantity	£2,430.18/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-3R alpha/CD123, Human (HEK293, His)

IL-3R alpha/CD123, Human (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.