IL-3R alpha/CD123, Mouse (HEK293, His)
IL-3R alpha/CD123, Mouse (HEK293, His)
SKU:QM-0092292
Request quote or documents

Product Details
-
Description
IL-3R alpha/CD123 protein, a receptor for IL3, is expressed on hematopoietic cells and governs their production and differentiation. Upon ligand binding, it heterodimerizes with IL3RB, activating JAK2 and PI3K. This activation leads to cell proliferation and differentiation, mediated by STAT5. IL-3R alpha interacts with IL3 and forms heterodimers with alpha and beta subunits, contributing to hematopoietic cell development. IL-3R alpha/CD123 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-8*His labeled tag.
-
Molecular Formula
16188 (Gene_ID) P26952-1 (S17-K331) (Accession)
-
Smiles
SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK
-
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Related Products
Other industry favorites
IL-3R alpha/CD123, Mouse (HEK293, His)
IL-3R alpha/CD123, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.