Skip to product information
1 of 1

IL-3R alpha/CD123, Mouse (HEK293, His)

IL-3R alpha/CD123, Mouse (HEK293, His)

Size

SKU:QM-0092292

Price on request
Quantity

Request quote or documents

View full details
  • Description

    IL-3R alpha/CD123 protein, a receptor for IL3, is expressed on hematopoietic cells and governs their production and differentiation. Upon ligand binding, it heterodimerizes with IL3RB, activating JAK2 and PI3K. This activation leads to cell proliferation and differentiation, mediated by STAT5. IL-3R alpha interacts with IL3 and forms heterodimers with alpha and beta subunits, contributing to hematopoietic cell development. IL-3R alpha/CD123 Protein, Mouse (HEK293, His) is the recombinant mouse-derived IL-3R alpha/CD123 protein, expressed by HEK293 , with C-8*His labeled tag.

  • Molecular Formula

    16188 (Gene_ID) P26952-1 (S17-K331) (Accession)

  • Smiles

    SDLAAVREAPPTAVTTPIQNLHIDPAHYTLSWDPAPGADITTGAFCRKGRDIFVWADPGLARCSFQSLSLCHVTNFTVFLGKDRAVAGSIQFPPDDDGDHEAAAQDLRCWVHEGQLSCQWERGPKATGDVHYRMFWRDVRLGPAHNRECPHYHSLDVNTAGPAPHGGHEGCTLDLDTVLGSTPNSPDLVPQVTITVNGSGRAGPVPCMDNTVDLQRAEVLAPPTLTVECNGSEAHARWVARNRFHHGLLGYTLQVNQSSRSEPQEYNVSIPHFWVPNAGAISFRVKSRSEVYPRKLSSWSEAWGLVCPPEVMPVK

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
1 EachQM-0092292
1 EachQM-0092292
£0.00/ea
£0.00
£0.00/ea £0.00

IL-3R alpha/CD123, Mouse (HEK293, His)

IL-3R alpha/CD123, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.