Skip to product information
1 of 1

IL-4, Canine

IL-4, Canine

Size

SKU:QM-0187906-01

£306.37 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    The IL-4 protein actively participates in the B cell activation process, acting as a costimulator for DNA synthesis. It induces the expression of class II MHC molecules on resting B cells, enhances IgE and IgG1 secretion and cell surface expression, and modulates CD23 expression on lymphocytes and monocytes. IL-4 Protein, Canine is the recombinant canine-derived IL-4 protein, expressed by E. coli , with no tag.

  • Molecular Formula

    403785 (Gene_ID) O77762 (H25-H132) (Accession)

  • Smiles

    HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH

  • Purity

    97.6

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
20 µgQM-0187906-01
20 µgQM-0187906-01
£306.37/ea
£0.00
£306.37/ea £0.00
50 µgQM-0187906-02
50 µgQM-0187906-02
£531.14/ea
£0.00
£531.14/ea £0.00
100 µgQM-0187906-03
100 µgQM-0187906-03
£769.28/ea
£0.00
£769.28/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-4, Canine

IL-4, Canine is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.