Skip to product information
1 of 1

IL-4, Porcine (CHO)

IL-4, Porcine (CHO)

Size

SKU:QM-0173920-01

£227.39 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-4 Protein, Porcine (CHO) is the prime anti-infalmmatory cytokine involves in cell proliferation, various gene expression and avert apoptosis in IL-4 expressing cells.

  • Molecular Formula

    397225 (Gene_ID) Q04745 (H25-C133) (Accession)

  • Smiles

    HKCDITLQEIIKTLNILTARKNSCMELPVTDVFAAPENTTEKETFCRASTVLRHIYRHHTCMKSLLSGLDRNLSSMANMTCSVHEAKKSTLKDFLERLKTIMKEKYSKC

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0173920-01
10 µgQM-0173920-01
£227.39/ea
£0.00
£227.39/ea £0.00
50 µgQM-0173920-02
50 µgQM-0173920-02
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-4, Porcine (CHO)

IL-4, Porcine (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.