Skip to product information
1 of 1

IL-4R alpha/CD124, Mouse (HEK293, Fc)

IL-4R alpha/CD124, Mouse (HEK293, Fc)

Size

SKU:QM-0187422-01

£127.38 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-4R alpha is a subunit alpha shared by IL-4 and IL-13 receptors, found in leukocytes originally. IL-4R alpha couples to the JAK1/2/3-STAT6 pathway and involves in promoting Th2 differentiation. IL-4R alpha/CD124, exerts IL-4 binding function and results the phosphorylation of C-terminal tyrosine residues. IL-4R alpha/CD124, Mouse has an immunoreceptor tyrosine inhibitor motif (ITIM) (707-712 a.a), which can bind to the SH2 domain of some phosphatases by phosphorylating ITIM. IL-4R alpha/CD124 Protein, Mouse (HEK293, Fc) has a transmembrane domain (234-257 a.a) . IL-4R alpha/CD124 Protein, Mouse is produced in HEK293 cells, including a Fibronectin typr III domain and a C-terminal hFC-tag.

  • Molecular Formula

    16190 (Gene_ID) P16382-1 (I26-R233) (Accession)

  • Smiles

    IKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLCLHYRLMFFEFSENLTCIPRNSASTVCVCHMEMNRPVQSDRYQMELWAEHRQLWQGSFSPSGNVKPLAPDNLTLHTNVSDEWLLTWNNLYPSNNLLYKDLISMVNISREDNPAEFIVYNVTYKEPRLSFPINILMSGVYYTARVRVRSQILTGTWSEWSPSITWYNHFQLPLIQR

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0187422-01
10 µgQM-0187422-01
£127.38/ea
£0.00
£127.38/ea £0.00
50 µgQM-0187422-02
50 µgQM-0187422-02
£381.69/ea
£0.00
£381.69/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-4R alpha/CD124, Mouse (HEK293, Fc)

IL-4R alpha/CD124, Mouse (HEK293, Fc) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.