IL-5, Mouse (CHO)

Name: IL-5, Mouse (CHO)
Brand: QuantiMol
SKU: QM-0204587-01
Price: 62.26 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0204587-01

£62.26 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-5 Protein, Mouse (CHO) is a CHO cell derived hematopoietic growth factor expressed in Th2, mast cells and eosinophils.
Molecular Formula
16191 (Gene_ID) P04401 (M21-G133) (Accession)
Smiles
MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0204587-01	2 µgQM-0204587-01 £62.26/ea	£0.00	Quantity	£62.26/ea	£0.00

10 µgQM-0204587-02	10 µgQM-0204587-02 £122.88/ea	£0.00	Quantity	£122.88/ea	£0.00

50 µgQM-0204587-03	50 µgQM-0204587-03 £376.83/ea	£0.00	Quantity	£376.83/ea	£0.00

100 µgQM-0204587-04	100 µgQM-0204587-04 £604.04/ea	£0.00	Quantity	£604.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-5, Mouse (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.