IL-5, Rat (CHO)

Name: IL-5, Rat (CHO)
Brand: QuantiMol
SKU: QM-0194388-01
Price: 143.13 GBP
Availability: InStock

Size 10 µg 50 µg 100 µg

SKU:QM-0194388-01

£143.13 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-5 Protein, Rat (CHO), a CHO cell derived cytokine, stimulates B cell growth and increases immunoglobulin secretion.
Molecular Formula
24497 (Gene_ID) Q08125 (M20-V132) (Accession)
Smiles
MEIPMSTVVKETLIQLSTHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEILFQNLSLIKKYIDGQKEKCGEERRKTRHFLDYLQEFLGVMSTEWAMEV
Purity
96
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0194388-01	10 µgQM-0194388-01 £143.13/ea	£0.00	Quantity	£143.13/ea	£0.00

50 µgQM-0194388-02	50 µgQM-0194388-02 £409.64/ea	£0.00	Quantity	£409.64/ea	£0.00

100 µgQM-0194388-03	100 µgQM-0194388-03 £658.72/ea	£0.00	Quantity	£658.72/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-5, Rat (CHO) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.