IL-6, Canine

Name: IL-6, Canine
Brand: QuantiMol
SKU: QM-0203803-01
Price: 94.75 GBP
Availability: InStock

Size 5 µg 10 µg 50 µg 100 µg

SKU:QM-0203803-01

£94.75 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-6 is a multifunctional cytokine that binds to IL6R and forms a complex with IL6ST/gp130 to initiate intracellular signaling. It induces "classical signaling" and "trans signaling" by interacting with membrane-bound IL6R or soluble IL6R. IL-6 Protein, Canine is the recombinant canine-derived IL-6 protein, expressed by E. coli , with tag free.
Molecular Formula
403985 (Gene_ID) P41323 (T23-M207) (Accession)
Smiles
TPGPLAGDSKDDATSNSLPLTSANKVEELIKYILGKISALRKEMCDKFNKCEDSKEALAENNLHLPKLEGKDGCFQSGFNQETCLTRITTGLVEFQLHLNILQNNYEGDKENVKSVHMSTKILVQMLKSKVKNQDEVTTPDPTTDASLQAILQSQDECVKHTTIHLILRSLEDFLQFSLRAVRIM
Purity
98
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
5 µgQM-0203803-01	5 µgQM-0203803-01 £94.75/ea	£0.00	Quantity	£94.75/ea	£0.00

10 µgQM-0203803-02	10 µgQM-0203803-02 £137.50/ea	£0.00	Quantity	£137.50/ea	£0.00

50 µgQM-0203803-03	50 µgQM-0203803-03 £392.63/ea	£0.00	Quantity	£392.63/ea	£0.00

100 µgQM-0203803-04	100 µgQM-0203803-04 £604.04/ea	£0.00	Quantity	£604.04/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-6, Canine is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.