IL-6, Human (N-His)

Name: IL-6, Human (N-His)
Brand: QuantiMol
SKU: QM-0203178-01
Price: 63.29 GBP
Availability: InStock

Size 2 µg 10 µg 50 µg 100 µg

SKU:QM-0203178-01

£63.29 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IL-6 protein is a multifunctional cytokine that plays multiple biological functions in immunity, tissue regeneration, and metabolism. After binding to IL6R, the resulting complex binds to the signaling subunit IL6ST/gp130, triggering the intracellular IL6 signaling pathway. IL-6 Protein, Human (N-His) is the recombinant human-derived IL-6 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
3569 (Gene_ID) P05231 (P29-M212) (Accession)
Smiles
PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Purity
95
Storage Conditions
Stored at -20°C for 2 years
Shipping Conditions
Room temperature in continental US; may vary elsewhere.

Your cart
Variant	Variant total	Quantity	Price	Variant total
2 µgQM-0203178-01	2 µgQM-0203178-01 £63.29/ea	£0.00	Quantity	£63.29/ea	£0.00

10 µgQM-0203178-02	10 µgQM-0203178-02 £143.13/ea	£0.00	Quantity	£143.13/ea	£0.00

50 µgQM-0203178-03	50 µgQM-0203178-03 £404.78/ea	£0.00	Quantity	£404.78/ea	£0.00

100 µgQM-0203178-04	100 µgQM-0203178-04 £545.72/ea	£0.00	Quantity	£545.72/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IL-6, Human (N-His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.