Skip to product information
1 of 1

IL-6R alpha, Mouse (HEK293, His)

IL-6R alpha, Mouse (HEK293, His)

Size

SKU:QM-0194226-01

£88.00 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-6R alpha is a subunit alpha of IL-6 receptors, also shared by other interleukin receptors. IL-6R alpha acts as IL-6 agonist and involves in JAK/STAT, MAPK, and Akt signaling pathway[1][2]. IL-6R alpha, Mouse consists of 460 amino acids (M1-R460) with two fibronectin type-III-like domains contained in the N-terminal part (109-214 a.a, 215-313 a.a) . Soluble IL-6R (sIL-6R) can be detected in the cerebrospinal fluid, conducts trans signaling by binding IL-6 and dimerized gp130, and exhibits a immune tissue expression property. IL-6R alpha Protein, Mouse (HEK293, His) is soluble form and produced in HEK293 cells with a C-Terminal His-tag.

  • Molecular Formula

    16194 (Gene_ID) P22272 (L20-P364) (Accession)

  • Smiles

    LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNVTIHWVYSGSQNREWTTTGNTLVLRDVQLSDTGDYLCSLNDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAICEWRPSSTPSPTTKAVLFAKKINTTNGKSDFQVPCQYSQQLKSFSCQVEILEGDKVYHIVSLCVANSVGSKSSHNEAFHSLKMVQPDPPANLVVSAIPGRPRWLKVSWQHPETWDPSYYLLQFQLRYRPVWSKEFTVLLLPVAQYQCVIHDALRGVKHVVQVRGKEELDLGQWSEWSPEVTGTPWIAEPRTTPAGILWNPTQVSVEDSANHEDQYESSTEATSVLAPVQESSSMSLP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0194226-01
2 µgQM-0194226-01
£88.00/ea
£0.00
£88.00/ea £0.00
10 µgQM-0194226-02
10 µgQM-0194226-02
£243.19/ea
£0.00
£243.19/ea £0.00
50 µgQM-0194226-03
50 µgQM-0194226-03
£591.89/ea
£0.00
£591.89/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-6R alpha, Mouse (HEK293, His)

IL-6R alpha, Mouse (HEK293, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.