1 1

IL-7, Human

IL-7, Human

Size

QM-0077935-01

£73.65 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    IL-7 Protein, Human, a hematopoietic cytokine, promotes T-cell recovery after allogeneic stem cell transplantation.

  • Molecular Formula

    3574 (Gene_ID) P13232-1 (D26-H177) (Accession)

  • Smiles

    DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
2 µgQM-0077935-01
2 µgQM-0077935-01
£73.65/ea		 £0.00
£73.65/ea £0.00
10 µgQM-0077935-02
10 µgQM-0077935-02
£199.44/ea		 £0.00
£199.44/ea £0.00
50 µgQM-0077935-03
50 µgQM-0077935-03
£437.58/ea		 £0.00
£437.58/ea £0.00
100 µgQM-0077935-04
100 µgQM-0077935-04
£714.61/ea		 £0.00
£714.61/ea £0.00
500 µgQM-0077935-05
500 µgQM-0077935-05
£1,765.58/ea		 £0.00
£1,765.58/ea £0.00
1 mgQM-0077935-06
1 mgQM-0077935-06
£2,794.68/ea		 £0.00
£2,794.68/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

IL-7, Human

IL-7, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.