Skip to product information
1 of 1

IL-7, Human (CHO, His)

IL-7, Human (CHO, His)

Size

SKU:QM-0190814-01

£306.37 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-7 protein is an important hematopoietic cytokine that is essential for the development, expansion and survival of T cells and B cells, regulating mature lymphocyte populations and maintaining lymphatic homeostasis. IL-7 interacts with IL7RA and CSF2RG subunits, activates kinases, including JAK1 or JAK3, and initiates signaling cascades, such as the PI3K/Akt/mTOR or JAK-STAT5 pathway. IL-7 Protein, Human (CHO, His) is the recombinant human-derived IL-7 protein, expressed by CHO , with C-His labeled tag.

  • Molecular Formula

    3574 (Gene_ID) P13232-1 (D26-H177) (Accession)

  • Smiles

    DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0190814-01
10 µgQM-0190814-01
£306.37/ea
£0.00
£306.37/ea £0.00
50 µgQM-0190814-02
50 µgQM-0190814-02
£769.28/ea
£0.00
£769.28/ea £0.00
100 µgQM-0190814-03
100 µgQM-0190814-03
£1,068.17/ea
£0.00
£1,068.17/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-7, Human (CHO, His)

IL-7, Human (CHO, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.