Skip to product information
1 of 1

IL-9, Mouse (CHO, His)

IL-9, Mouse (CHO, His)

Size

SKU:QM-0177808-01

£216.46 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IL-9 Protein, Mouse (CHO), derived from CHO cell, is a member of the TH2 cytokine family.IL-9 Protein, Mouse (CHO, His) has recently been implicated as an essential factor in determining mucosal immunity and susceptibility to atopic asthma.

  • Molecular Formula

    16198 (Gene_ID) P15247 (Q19-P144) (Accession)

  • Smiles

    QRCSTTWGIRDTNYLIENKLDDPPSKCSCSGNVTSCLCLSVPTDDCTTPCYREGLLQLTNATQKSRLLPVFHRVKRIVEVLKNITCPSFSCEKPCNQTMAGNTLSFLKSLLGTFQKTEMQRQKSRP

  • Purity

    95

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
10 µgQM-0177808-01
10 µgQM-0177808-01
£216.46/ea
£0.00
£216.46/ea £0.00
50 µgQM-0177808-02
50 µgQM-0177808-02
£515.35/ea
£0.00
£515.35/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IL-9, Mouse (CHO, His)

IL-9, Mouse (CHO, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.