IMPA1, Human (His)

Name: IMPA1, Human (His)
Brand: QuantiMol
SKU: QM-0084710-01
Price: 268.19 GBP
Availability: InStock

Size 10 µg 50 µg

SKU:QM-0084710-01

£268.19 GBP

Sale Sold out

Quote Datasheet SDS COA

Product Details

Description
IMPA1 protein provides essential inositol for the synthesis of phosphatidylinositol and polyphosphate inositol. IMPA1 Protein, Human (His) is the recombinant human-derived IMPA1 protein, expressed by E. coli , with N-6*His labeled tag.
Molecular Formula
3612 (Gene_ID) P29218-1 (M1-D277) (Accession)
Smiles
MADPWQECMDYAVTLARQAGEVVCEAIKNEMNVMLKSSPVDLVTATDQKVEKMLISSIKEKYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHRFPFVAVSIGFAVNKKIEFGVVYSCVEGKMYTARKGKGAFCNGQKLQVSQQEDITKSLLVTELGSSRTPETVRMVLSNMEKLFCIPVHGIRSVGTAAVNMCLVATGGADAYYEMGIHCWDVAGAGIIVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDED
Purity
98
Storage Conditions
Stored at -80°C for 1 year
Shipping Conditions
Dry ice.

Your cart
Variant	Variant total	Quantity	Price	Variant total
10 µgQM-0084710-01	10 µgQM-0084710-01 £268.19/ea	£0.00	Quantity	£268.19/ea	£0.00

50 µgQM-0084710-02	50 µgQM-0084710-02 £655.77/ea	£0.00	Quantity	£655.77/ea	£0.00

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.

IMPA1, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.