Skip to product information
1 of 1

IMPA2, Human (His)

IMPA2, Human (His)

Size

SKU:QM-0115388-01

£595.02 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    IMPA2, or Inositol monophosphatase 2, demonstrates enzymatic activity by utilizing various substrates such as myo-inositol monophosphates, scylloinositol 1,4-diphosphate, glucose-1-phosphate, beta-glycerophosphate, and 2'-AMP. Additionally, it has been implicated as the pharmacological target for the action of lithium ions (Li⁺) in the brain. IMPA2 Protein, Human (His) is the recombinant human-derived IMPA2 protein, expressed by E. coli , with N-6*His labeled tag.

  • Molecular Formula

    3613 (Gene_ID) O14732-1 (M1-K288) (Accession)

  • Smiles

    MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELRERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEERLYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLALCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTINYGRDDEK

  • Purity

    98

  • Storage Conditions

    Stored at -80°C for 1 year

  • Shipping Conditions

    Dry ice.

Your cart
Variant Variant total Quantity Price Variant total
50 µgQM-0115388-01
50 µgQM-0115388-01
£595.02/ea
£0.00
£595.02/ea £0.00
100 µgQM-0115388-02
100 µgQM-0115388-02
£932.79/ea
£0.00
£932.79/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IMPA2, Human (His)

IMPA2, Human (His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.