1 1

Interferon tau-1/IFNT1, Bovine (P.pastoris, His)

Interferon tau-1/IFNT1, Bovine (P.pastoris, His)

Size

QM-0188800-01

£448.52 GBP
Sale Sold out

Request quote or documents

View full details

Product Details

  • Description

    Interferon tau-1 (IFNT1) serves as an important paracrine hormone that initiates maternal recognition of pregnancy. After interacting with endometrial receptors, possibly type I interferon receptors, IFNT1 blocks estrogen receptor expression and prevents estrogen-induced upregulation of oxytocin receptor expression. Interferon tau-1/IFNT1 Protein, Bovine (P.pastoris, His) is the recombinant bovine-derived Interferon tau-1/IFNT1 protein, expressed by P. pastoris , with N-His labeled tag.

  • Molecular Formula

    317698 (Gene_ID) P15696 (C24-L195) (Accession)

  • Smiles

    CYLSEDHMLGARENLRLLARMNRLSPHPCLQDRKDFGLPQEMVEGNQLQKDQAISVLHEMLQQCFNLFYTEHSSAAWNTTLLEQLCTGLQQQLEDLDACLGPVMGEKDSDMGRMGPILTVKKYFQGIHVYLKEKEYSDCAWEIIRVEMMRALSSSTTLQKRLRKMGGDLNSL

  • Purity

    90

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.
Learn more
Variant Variant total Quantity Price Variant total
20 µgQM-0188800-01
20 µgQM-0188800-01
£448.52/ea		 £0.00
£448.52/ea £0.00
50 µgQM-0188800-02
50 µgQM-0188800-02
£924.80/ea		 £0.00
£924.80/ea £0.00
View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

Related Products

Other industry favorites

Interferon tau-1/IFNT1, Bovine (P.pastoris, His)

Interferon tau-1/IFNT1, Bovine (P.pastoris, His) is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.