Skip to product information
1 of 1

IP-10/CXCL10, Human

IP-10/CXCL10, Human

Size

SKU:QM-0203168-01

£52.94 GBP
Sale Sold out
Quantity

Request quote or documents

View full details
  • Description

    CXCL10, also known as interferon γ-induced protein 10 kDa (IP-10), is a cytokine belonging to the CXC chemokine family. CXCL10 exerts its biological effects by binding to CXCR3. CXCL10 is a pleiotropic molecule capable of exerting potent biological functions, including promoting the chemotactic activity of CXCR3+ cells, inducing apoptosis, regulating cell growth and proliferation as well as angiogenesis in infectious and inflammatory diseases and cancer[1]. IP-10/CXCL10 Protein, Human consists of 77 amino acids (V22-P98) and is expressed in E. coli.

  • Molecular Formula

    3627 (Gene_ID) P02778 (V22-P98) (Accession)

  • Smiles

    VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP

  • Purity

    98

  • Storage Conditions

    Stored at -20°C for 2 years

  • Shipping Conditions

    Room temperature in continental US; may vary elsewhere.

Your cart
Variant Variant total Quantity Price Variant total
2 µgQM-0203168-01
2 µgQM-0203168-01
£52.94/ea
£0.00
£52.94/ea £0.00
10 µgQM-0203168-02
10 µgQM-0203168-02
£103.75/ea
£0.00
£103.75/ea £0.00
50 µgQM-0203168-03
50 µgQM-0203168-03
£271.13/ea
£0.00
£271.13/ea £0.00
100 µgQM-0203168-04
100 µgQM-0203168-04
£426.65/ea
£0.00
£426.65/ea £0.00

View cart
0

Total items

£0.00

Product subtotal

Taxes, discounts and shipping calculated at checkout.
View cart

IP-10/CXCL10, Human

IP-10/CXCL10, Human is a premium-grade research compound supplied by Quantimol for laboratory and scientific applications.